PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0445s0032.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 505aa    MW: 55724.7 Da    PI: 6.8635
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0445s0032.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61.1e-31107160255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+vkgL+++hvkSHLQ++R+
  Kalax.0445s0032.1.p 107 PRLRWTPDLHMCFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMFRS 160
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.326103163IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-30103161IPR009057Homeodomain-like
SuperFamilySSF466894.12E-14105161IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-22107162IPR006447Myb domain, plants
PfamPF002491.1E-7108158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MASSAETPTK VAIEIISDDE NLSGRSSSQQ SAKAEHHPTL RKSSSVLDLN ERAKGDVEEE  60
NQIGDCDDQF DEEGNSTSSN NDDDRGDEKK RNNGTNTVRQ YVRSKMPRLR WTPDLHMCFV  120
HAVERLGGQE RATPKLVLQL MNVKGLSIAH VKSHLQMFRS KKLDESGQVL SHHQNGPAGH  180
GKHHHQMMEM TYQRGLHTSS HHPYAYPHFK IDHSNRSGSS SSIDHVTFPL FKPSLNSPRN  240
QSWPMTGHPM ARWSKDLGLA PGYPPSHEPR SASPKHFGPI RQSHFLERRW PASGFGLGSE  300
DRHRCRNAST SHNAAYDWDK SHHPGYHLNL GNVLSLGNSQ IASTSTMLTT TTTLASKEVS  360
NSSPTLSMST SSDRELGAPF HLKLLQRLEE ERISSMEDMM VADVEKHEEK LDGEVERIRS  420
CQPNLQLSLS HTDETGKKPS GDGGGLGSSS VDTALSLSIS LSAPAAVGVE EELTVEKCEG  480
GDIGEEIRRW GSCEMVRSKA TIWG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-37G2-like family protein